PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00095.37
Common NameAMTR_s00095p00071020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 206aa    MW: 22699.8 Da    PI: 9.9084
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00095.37genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-3347101155
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                              k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00095.37  47 KQRLRWTSDLHDRFVDAIAQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 101
                                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.13444104IPR017930Myb domain
SuperFamilySSF466892.33E-1746101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-3246102IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-2647102IPR006447Myb domain, plants
PfamPF002492.0E-849100IPR001005SANT/Myb domain
PfamPF143792.8E-10134154IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MYYPKKFSTM GLVPHKPQSQ GADQLANIGV SGGSPINKSP TSGGAGKQRL RWTSDLHDRF  60
VDAIAQLGGP DRATPKGVLR VMGVPGLTIY HVKSHLQKYR LAKYLPDSPA DGTKDEKKES  120
SDILPNMESA PGAQISEALR MQMEVQKRLH EQLEGLELEP SLTDSAECTW SRTWRLGWGK  180
VIYGVQWFKT RIQLGIRQDP SSSNV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011620394.11e-108PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN52e-37PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLW1NQQ41e-151W1NQQ4_AMBTC; Uncharacterized protein
STRINGVIT_08s0040g00100.t011e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.19e-60G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]